Antibody data

Product number
H00005613-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005613-M01, RRID:AB_1237835
Product name
PRKX monoclonal antibody (M01), clone 1H7
Provider product page
Abnova Corporation - H00005613-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PRKX.
Antigen sequence
FHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWF
RSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPE
NDWDTAAPVPQKDLEIFKNF
Isotype
IgG
Antibody clone number
1H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -