HPA015324

PRKX antibody from MilliporeSigma / Merck KGaA
PKX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015324
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015324, RRID:AB_1855715
Product name
Anti-PRKX antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015324
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PRKX recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHR
WFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETY
PENDWD
Storage
-20C
Provider Type Product Number
- No reagents -