Antibody data

Product number
PAB24002
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB24002, RRID:AB_11121570
Product name
FKBP6 polyclonal antibody
Provider product page
Abnova Corporation - PAB24002
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human FKBP6.
Reactivity
Human
Host
Rabbit
Antigen sequence
PEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYG
EQALIIDQKNAKALFRCGQACLLLTEYQKARDFLV
RAQKEQPFNHDINNELKKLAS
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -