HPA005990

SELP antibody from Atlas Antibodies
CD62, CD62P, GMP140, GRMP, PADGEM, PSEL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005990
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005990, RRID:AB_888811
Product name
Anti-SELP
Provider product page
Atlas Antibodies - HPA005990
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVE
CTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQ
GTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLS
CRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
W
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -