HPA005990

SELP antibody from Sigma-Aldrich
CD62, CD62P, GMP140, GRMP, PADGEM, PSEL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005990
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005990, RRID:AB_1078479
Product name
Anti-SELP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005990
Antibody type
Polyclonal
Antigen
P-selectin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVE
CTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQ
GTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLS
CRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
W
Storage
-20C
Provider Type Product Number
- No reagents -