AV36232

ZNF596 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
AV36232
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36232, RRID:AB_1859367
Product name
Anti-ZNF596 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36232
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF596 with an internal ID of P07587
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFN
LRQHERTHTKKAMNM
Storage
-20C
Provider Type Product Number
- No reagents -