HPA004877

ICAM1 antibody from Sigma-Aldrich
BB2, CD54
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004877
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004877, RRID:AB_1846317
Product name
Anti-ICAM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004877
Antibody type
Polyclonal
Antigen
Intercellular adhesion molecule 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELS
NVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVE
LAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLR
GEKELKREPAVGEPAEVTTTVLVRRD
Storage
-20C
Provider Type Product Number
- No reagents -