Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000832-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000832-M03, RRID:AB_518702
- Product name
- CAPZB monoclonal antibody (M03), clone 4H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAPZB.
- Antigen sequence
SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRS
TLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKND
LVEALKRKQQC- Isotype
- IgG
- Antibody clone number
- 4H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle.
Functional analysis of beef tenderness.
Picard B, Gagaoua M, Micol D, Cassar-Malek I, Hocquette JF, Terlouw CE
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Functional analysis of beef tenderness.
Guillemin N, Bonnet M, Jurie C, Picard B
Journal of proteomics 2011 Dec 21;75(2):352-65
Journal of proteomics 2011 Dec 21;75(2):352-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAPZB monoclonal antibody (M03), clone 4H8 Western Blot analysis of CAPZB expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol