H00009502-B01P

XAGE2 antibody from Abnova Corporation
CT12.2, GAGED3, XAGE-2, XAGE2B

Antibody data

Product number
H00009502-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009502-B01P, RRID:AB_1581954
Product name
XAGE2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00009502-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human XAGE2 protein.
Antigen sequence
MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPK
EEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADL
QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAG
EGKSQV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -