Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002274 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002274, RRID:AB_1078435
- Product name
- Anti-ITGAM
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLV
PVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHS
DFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEF
NATLKGNLSFDWYIKTSHNHLLIVSTAEIL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions.
Deposition of Complement in Human Acute Brain Ischaemia
Zibert JR, Wallbrecht K, Schön M, Mir LM, Jacobsen GK, Trochon-Joseph V, Bouquet C, Villadsen LS, Cadossi R, Skov L, Schön MP
The Journal of clinical investigation 2011 Jan;121(1):410-21
The Journal of clinical investigation 2011 Jan;121(1):410-21
Deposition of Complement in Human Acute Brain Ischaemia
Pedersen E, Løberg E, Vege E, Daha M, Maehlen J, Mollnes T
Scandinavian Journal of Immunology 2009 June;69(6):555-562
Scandinavian Journal of Immunology 2009 June;69(6):555-562
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in red pulp.