Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002274 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002274, RRID:AB_1078435
- Product name
- Anti-ITGAM
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLV
PVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHS
DFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEF
NATLKGNLSFDWYIKTSHNHLLIVSTAEIL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Extracellular nicotinate phosphoribosyltransferase binds Toll like receptor 4 and mediates inflammation
Inflammation-linked adaptations in dermal microvascular reactivity accompany the development of obesity and type 2 diabetes
Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions
In SituDeposition of Complement in Human Acute Brain Ischaemia
Managò A, Audrito V, Mazzola F, Sorci L, Gaudino F, Gizzi K, Vitale N, Incarnato D, Minazzato G, Ianniello A, Varriale A, D’Auria S, Mengozzi G, Politano G, Oliviero S, Raffaelli N, Deaglio S
Nature Communications 2019;10(1)
Nature Communications 2019;10(1)
Inflammation-linked adaptations in dermal microvascular reactivity accompany the development of obesity and type 2 diabetes
Nguyen-Tu M, Nivoit P, Oréa V, Lemoine S, Acquaviva C, Pagnon-Minot A, Fromy B, Sethi J, Sigaudo-Roussel D
International Journal of Obesity 2018;43(3):556-566
International Journal of Obesity 2018;43(3):556-566
Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions
Zibert J, Wallbrecht K, Schön M, Mir L, Jacobsen G, Trochon-Joseph V, Bouquet C, Villadsen L, Cadossi R, Skov L, Schön M
Journal of Clinical Investigation 2011;121(1):410-421
Journal of Clinical Investigation 2011;121(1):410-421
In SituDeposition of Complement in Human Acute Brain Ischaemia
Pedersen E, Løberg E, Vege E, Daha M, Mæhlen J, Mollnes T
Scandinavian Journal of Immunology 2009;69(6):555-562
Scandinavian Journal of Immunology 2009;69(6):555-562
No comments: Submit comment
No validations: Submit validation data