HPA002274

ITGAM antibody from Sigma-Aldrich
CD11B, CR3A, MAC-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002274
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002274, RRID:AB_1078435
Product name
Anti-ITGAM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002274
Antibody type
Polyclonal
Antigen
Integrin alpha-M precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLV
PVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHS
DFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEF
NATLKGNLSFDWYIKTSHNHLLIVSTAEIL
Storage
-20C
Provider Type Product Number
- No reagents -