HPA022828

TMEM99 antibody from Sigma-Aldrich
MGC21518
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022828
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022828, RRID:AB_1858139
Product name
Anti-TMEM99 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022828
Antibody type
Polyclonal
Antigen
Transmembrane protein 99 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWLLFNNWTGGSWFSLHLQQVSLSQGSHVAAFLPE
AIGPGVPVPVSGESTSAQQSHAGWQLSAEADACPS
VLYSEVLEWNK
Storage
-20C
Provider Type Product Number
- No reagents -