HPA001887

CD14 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001887
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001887, RRID:AB_1078442
Product name
Anti-CD14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001887
Antibody type
Polyclonal
Antigen
Monocyte differentiation antigen CD14 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVE
IHAGGLNLEPFLKRVDADADPRQYADTVKALRVRR
LTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKI
TGTMPPLPLEATGLALSSL
Storage
-20C
Provider Type Product Number
- No reagents -