Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405727 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Desmocollin 3 (DSC3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DSC3 antibody: synthetic peptide directed towards the N terminal of human DSC3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGV
DKEPL NLFYIERDTG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Altered expression of desmocollin 3, desmoglein 3, and beta-catenin in oral squamous cell carcinoma: correlation with lymph node metastasis and cell proliferation.
Wang L, Liu T, Wang Y, Cao L, Nishioka M, Aguirre RL, Ishikawa A, Geng L, Okada N
Virchows Archiv : an international journal of pathology 2007 Nov;451(5):959-66
Virchows Archiv : an international journal of pathology 2007 Nov;451(5):959-66
No comments: Submit comment
No validations: Submit validation data