HPA001412

CSF3 antibody from Sigma-Aldrich
C17orf33, G-CSF, GCSF, MGC45931
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001412
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001412, RRID:AB_1079019
Product name
Anti-CSF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001412
Antibody type
Polyclonal
Antigen
Granulocyte colony-stimulating factor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLG
IPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQ
ALEGISPELGPTLDTLQLDVADFATTIWQQMEELG
MAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF
L
Storage
-20C
Provider Type Product Number
- No reagents -