HPA000900

LIN52 antibody from Atlas Antibodies
C14orf46
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000900
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000900, RRID:AB_888575
Product name
Anti-LIN52
Provider product page
Atlas Antibodies - HPA000900
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQL
PGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKE
LGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGK
FLNILEKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -