HPA000905

PSMA3 antibody from Sigma-Aldrich
HC8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000905
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000905, RRID:AB_1079702
Product name
Anti-PSMA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000905
Antibody type
Polyclonal
Antigen
Proteasome subunit alpha type 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFG
CSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGK
ARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHD
EVKDKAFELELSWVGELTNGRHEIVPKDIREEAEK
YAKESL
Storage
-20C
Provider Type Product Number
- No reagents -