Antibody data

Product number
H00004794-M01
Provider
Abnova Corporation
Product name
NFKBIE monoclonal antibody (M01), clone 3F12
Provider product page
Abnova Corporation - H00004794-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NFKBIE.
Antigen sequence
SGKTALHLAVETQERGLVQFLLQAGAQVDARMLNG
CTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDET
PQDLTEESLVLLPFDDLKISGKLLLC
Isotype
IgG
Antibody clone number
3F12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -