HPA002692

NFKBIE antibody from Sigma-Aldrich
IKBE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002692
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002692, RRID:AB_1079479
Product name
Anti-NFKBIE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002692
Antibody type
Polyclonal
Antigen
NF-kappa-B inhibitor epsilon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEPGRGTSHSLDLQLQNWQGLACLHIATLQKNQPL
MELLLRNGADIDVQEGTSGKTALHLAVETQERGLV
QFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISST
LCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLK
I
Storage
-20C
Provider Type Product Number
- No reagents -