HPA023677

FBF1 antibody from Atlas Antibodies
ALB, FBF-1, FLJ00103, KIAA1863
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023677
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023677, RRID:AB_1848440
Product name
Anti-FBF1
Provider product page
Atlas Antibodies - HPA023677
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQA
LLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGK
GELPNHP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -