HPA024649

ARHGEF10 antibody from Sigma-Aldrich
Gef10, KIAA0294
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024649
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024649, RRID:AB_1845002
Product name
Anti-ARHGEF10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024649
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQPNSLSSEEPPTSEDQVGREDSALARWAADPANT
AWMENPEEAIYDDVPRENSDSEPDEMIYDDVENGD
EGGNSSLEYGWSSSEFESYEEQSDSECK
Storage
-20C
Provider Type Product Number
- No reagents -