Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006526-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006526-M02, RRID:AB_1714177
- Product name
- SLC5A3 monoclonal antibody (M02), clone 3A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC5A3.
- Antigen sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKM
QEKSILRCSENNETINHIIPNGKSEDSIKGLQPED
VNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAA
LMGE- Isotype
- IgG
- Antibody clone number
- 3A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Elevated extracellular glucose and uncontrolled type 1 diabetes enhance NFAT5 signaling and disrupt the transverse tubular network in mouse skeletal muscle.
Hernández-Ochoa EO, Robison P, Contreras M, Shen T, Zhao Z, Schneider MF
Experimental biology and medicine (Maywood, N.J.) 2012 Sep;237(9):1068-83
Experimental biology and medicine (Maywood, N.J.) 2012 Sep;237(9):1068-83
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SLC5A3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol