H00051561-B01

IL23A antibody from Abnova Corporation
IL-23, IL-23A, IL23P19, P19, SGRF

Antibody data

Product number
H00051561-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051561-B01, RRID:AB_915875
Product name
IL23A MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00051561-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IL23A protein.
Antigen sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQ
LSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPH
IQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLG
SDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGH
HWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAV
AARVFAHGAATLSP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -