HPA001554

IL23A antibody from Sigma-Aldrich
IL-23, IL-23A, IL23P19, P19, SGRF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001554, RRID:AB_1079135
Product name
Anti-IL23A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001554
Antibody type
Polyclonal
Antigen
Interleukin-23 subunit alpha-precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQ
GLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLG
LSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRF
Storage
-20C
Provider Type Product Number
- No reagents -