HPA021022

PRRC2B antibody from Sigma-Aldrich
BAT2L, BAT2L1, KIAA0515, LQFBS-1, MGC10526
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021022
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021022, RRID:AB_1852324
Product name
Anti-BAT2L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021022
Antibody type
Polyclonal
Antigen
Protein BAT2-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EREESTLKKGDCRDSWRSNKGCSEDHSGLDAKSRG
PRAFGRALPPRLSNCGYGRRTFVSKESPHWQSKSP
GSSWQEYGPSDTCGSRRPTDRDYVPDSYRHPDAFG
GR
Storage
-20C
Provider Type Product Number
- No reagents -