ABIN630949

antibody from antibodies-online

Targeting: VPS4A FLJ22197, SKD1, SKD1A, SKD2, VPS4, VPS4-1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630949 - Provider product page
Provider: antibodies-online
Product name: anti-Vacuolar Protein Sorting 4 Homolog A (S. Cerevisiae) (VPS4A) antibody
Antibody type: Polyclonal
Antigen: VPS4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

VPS4A protein structure - ABIN630949 shown in red.