H00027183-B01P

VPS4A antibody from Abnova Corporation
FLJ22197, SKD1, SKD1A, SKD2, VPS4, VPS4-1

Antibody data

Product number
H00027183-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027183-B01P, RRID:AB_1137678
Product name
VPS4A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00027183-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human VPS4A protein.
Antigen sequence
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHA
VEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKL
KDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPE
KKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALK
EAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSY
LAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVK
NLFELARQHKPSIIFIDEVDSLCGSRNENESEAAR
RIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSA
IRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLT
DANIHELARKTEGYSGADISIIVRDSLMQPVRKVQ
SATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAM
EMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -