HPA023394

HAP1 antibody from MilliporeSigma / Merck KGaA
HAP2, hHLP1, HIP5, HLP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023394
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023394, RRID:AB_1850492
Product name
Anti-HAP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023394
Antibody type
Polyclonal
Antigen
Huntingtin-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTGQRVGSRATSGTQFLSEARTGARPASEAGAKAG
ARRPSAFSAIQGDVRSMPDNSDAPWTRFVFQGPFG
SRATGRGTGKAAGIWK
Storage
-20C
Provider Type Product Number
- No reagents -