HPA023862

TTC25 antibody from Sigma-Aldrich
DKFZP434H0115
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023862, RRID:AB_1858432
Product name
Anti-TTC25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023862
Antibody type
Polyclonal
Antigen
Tetratricopeptide repeat protein 25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FYHRGYKLRPDREFRVGIQKAQEAINNSVGSPSSI
KLENKGDLSFLSKQAENIKAQQKPQPMKHLLHPTK
GEPKWKASLKSEKTVRQLLGELYVDKEYLEKLLLD
E
Storage
-20C
Provider Type Product Number
- No reagents -