HPA016464

GHITM antibody from Sigma-Aldrich
DERP2, HSPC282, My021, PTD010, TMBIM5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016464
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016464, RRID:AB_1849656
Product name
Anti-GHITM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016464
Antibody type
Polyclonal
Antigen
Growth hormone-inducible transmembrane protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLN
IFMRVATMLATGGNRKK
Storage
-20C
Provider Type Product Number
- No reagents -