HPA016464

GHITM antibody from Atlas Antibodies
DERP2, HSPC282, My021, PTD010, TMBIM5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016464
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016464, RRID:AB_1668984
Product name
Anti-GHITM
Provider product page
Atlas Antibodies - HPA016464
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLN
IFMRVATMLATGGNRKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -