HPA001852

TRAF1 antibody from Sigma-Aldrich
EBI6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001852, RRID:AB_1080344
Product name
Anti-TRAF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001852
Antibody type
Polyclonal
Antigen
TNF receptor-associated factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEH
EVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALE
QNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELA
LQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASH
LALATSI
Storage
-20C
Provider Type Product Number
- No reagents -