Antibody data

Product number
HPA023015
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023015, RRID:AB_1847804
Product name
Anti-DNAJC7
Provider product page
Atlas Antibodies - HPA023015
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGK
CHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNA
NAVME
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.