HPA023015

DNAJC7 antibody from Sigma-Aldrich
TPR2, TTC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023015
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023015, RRID:AB_1847804
Product name
Anti-DNAJC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023015
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGK
CHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNA
NAVME
Storage
-20C
Provider Type Product Number
- No reagents -