HPA001474

OASL antibody from Sigma-Aldrich
p59OASL, TRIP14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001474
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001474, RRID:AB_1079518
Product name
Anti-OASL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001474
Antibody type
Polyclonal
Antigen
59 kDa 2'->5'-Oligoadenylate synthetase-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVK
VGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHH
KDVLRLIWKTMWQSQDLLDLGLEDLRMEQRVPDAL
VFTIQTRGTAEPITVTIVPAYRAL
Storage
-20C
Provider Type Product Number
- No reagents -