Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009636-D01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009636-D01, RRID:AB_10731795
- Product name
- ISG15 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human ISG15 protein.
- Antigen sequence
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQK
IGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST
VLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVA
HLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY
GLKPLSTVFMNLRLRGGGTEPGGRS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in human spleen.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in HeLa.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ISG15 expression in transfected 293T cell line (H00009636-T01) by ISG15 MaxPab polyclonal antibody.Lane 1: ISG15 transfected lysate(17.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ISG15 transfected lysate using anti-ISG15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with G1P2 purified MaxPab mouse polyclonal antibody (B01P) (H00009636-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol