HPA004627

ISG15 antibody from Sigma-Aldrich
G1P2, IFI15, UCRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004627
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004627, RRID:AB_1079152
Product name
Anti-ISG15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004627
Antibody type
Polyclonal
Antigen
Interferon-induced 17 kDa protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAF
QQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVD
KCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQV
SGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLS
Storage
-20C
Provider Type Product Number
- No reagents -