HPA024238

CPSF2 antibody from Sigma-Aldrich
KIAA1367
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024238
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024238, RRID:AB_1847200
Product name
Anti-CPSF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024238
Antibody type
Polyclonal
Antigen
Cleavage and polyadenylation specificity factor subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSK
EADIDSSDESDIEEDIDQPSAHKTKHDLMMKGEGS
RKGSFFKQAKKSYPMFPAPEERIKWDEYGEIIKPE
DFLVPELQATEEEKSKLESGLTNGDEPMDQDLSDV
PTKCISTTESI
Storage
-20C
Provider Type Product Number
- No reagents -