Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503294 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytochrome C1 (CYC1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRH
KWSVL KSRKLAYRPP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Serum leucine-rich alpha-2-glycoprotein-1 binds cytochrome c and inhibits antibody detection of this apoptotic marker in enzyme-linked immunosorbent assay.
Cummings C, Walder J, Treeful A, Jemmerson R
Apoptosis : an international journal on programmed cell death 2006 Jul;11(7):1121-9
Apoptosis : an international journal on programmed cell death 2006 Jul;11(7):1121-9
No comments: Submit comment
No validations: Submit validation data