HPA001247

CYC1 antibody from Sigma-Aldrich
UQCR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001247
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001247, RRID:AB_1078602
Product name
Anti-CYC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001247
Antibody type
Polyclonal
Antigen
Cytochrome c1 heme protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLL
TGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYT
DVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHR
KRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLA
YR
Storage
-20C
Provider Type Product Number
- No reagents -