HPA022999

NBR1 antibody from Atlas Antibodies
1A1-3B, CA125, KIAA0049, M17S2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022999
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022999, RRID:AB_1859532
Product name
Anti-NBR1
Provider product page
Atlas Antibodies - HPA022999
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEK
KQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSP
LGRPESLLQSNTLMLPLQPCTSVMPMLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -