Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183233 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 175 (ZNF175) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF175 antibody: synthetic peptide directed towards the N terminal of human ZNF175
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVD
FSREE WQQLDPAQRC- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references OTK18 expression in brain mononuclear phagocytes parallels the severity of HIV-1 encephalitis.
Suppression of the immune response by benzodiazepine receptor inverse agonists.
Carlson KA, Limoges J, Pohlman GD, Poluektova LY, Langford D, Masliah E, Ikezu T, Gendelman HE
Journal of neuroimmunology 2004 May;150(1-2):186-98
Journal of neuroimmunology 2004 May;150(1-2):186-98
Suppression of the immune response by benzodiazepine receptor inverse agonists.
Arora PK, Hanna EE, Paul SM, Skolnick P
Journal of neuroimmunology 1987 May;15(1):1-9
Journal of neuroimmunology 1987 May;15(1):1-9
No comments: Submit comment
No validations: Submit validation data