HPA002717

ZNF175 antibody from Sigma-Aldrich
OTK18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002717
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002717, RRID:AB_1080681
Product name
Anti-ZNF175 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002717
Antibody type
Polyclonal
Antigen
Zinc finger protein 175 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QNQIQPMSHSAFFNKKTLNTESNCEYKDPGKMIRT
RPHLASSQKQPQKCCLFTESLKLNLEVNGQNESND
TEQLDDVVGSGQLFSHSSSDACSKNIHTGETFCKG
NQCRKVCGHKQSLKQHQ
Storage
-20C
Provider Type Product Number
- No reagents -