Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007692-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007692-M01, RRID:AB_1112228
- Product name
- ZNF133 monoclonal antibody (M01), clone 1C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF133.
- Antigen sequence
PGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFG
RTKKRTLGAFSRPPQRQPVSSRNGLRGVELEASPA
QTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKM
TNLLS- Isotype
- IgG
- Antibody clone number
- 1C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparative proteomics analysis of human osteosarcomas and benign tumor of bone.
Li Y, Liang Q, Wen YQ, Chen LL, Wang LT, Liu YL, Luo CQ, Liang HZ, Li MT, Li Z
Cancer genetics and cytogenetics 2010 Apr 15;198(2):97-106
Cancer genetics and cytogenetics 2010 Apr 15;198(2):97-106
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ZNF133 monoclonal antibody (M01), clone 1C6. Western Blot analysis of ZNF133 expression in SJCRH30(Cat # L027V1 ).