Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501661 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 133 (ZNF133) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the N terminal of human ZNF133
- Reactivity
- Human, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYS
NLVSL GISFSKPELI- Vial size
- 50 µg
Submitted references Liver fat: effect of hepatic iron deposition on evaluation with opposed-phase MR imaging.
PIAS1 interacts with the KRAB zinc finger protein, ZNF133, via zinc finger motifs and regulates its transcriptional activity.
Westphalen AC, Qayyum A, Yeh BM, Merriman RB, Lee JA, Lamba A, Lu Y, Coakley FV
Radiology 2007 Feb;242(2):450-5
Radiology 2007 Feb;242(2):450-5
PIAS1 interacts with the KRAB zinc finger protein, ZNF133, via zinc finger motifs and regulates its transcriptional activity.
Lee SJ, Lee JR, Hahn HS, Kim YH, Ahn JH, Bae CD, Yang JM, Hahn MJ
Experimental & molecular medicine 2007 Aug 31;39(4):450-7
Experimental & molecular medicine 2007 Aug 31;39(4):450-7
No comments: Submit comment
No validations: Submit validation data