HPA001493

ZNF133 antibody from Sigma-Aldrich
pHZ-13, pHZ-66, ZNF150
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001493
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001493, RRID:AB_1080666
Product name
Anti-ZNF133 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001493
Antibody type
Polyclonal
Antigen
Zinc finger protein 133 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKPELITQLEQGKETWREEKKCSPATCPADPEPEL
YLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAE
GNIQPGDPGPGDQEKQQQASEGRPWSDQAEGPEGE
GAMPLFGRTKKRTLG
Storage
-20C
Provider Type Product Number
- No reagents -