HPA019698

CDS2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019698
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019698, RRID:AB_1846464
Product name
Anti-CDS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019698
Antibody type
Polyclonal
Antigen
Phosphatidate cytidylyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDS
ESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Storage
-20C
Provider Type Product Number
- No reagents -