HPA014775

FAXDC2 antibody from MilliporeSigma / Merck KGaA
C5orf4, FLJ13758
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014775
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014775, RRID:AB_1845727
Product name
Anti-C5orf4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014775
Antibody type
Polyclonal
Antigen
Uncharacterized protein C5orf4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPNFISRYRIQVGKNEPVDPVKLRQSIRTV
Storage
-20C
Provider Type Product Number
- No reagents -