HPA026969

SGCD antibody from Atlas Antibodies
CMD1L, DAGD, LGMD2F
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026969
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026969, RRID:AB_1856796
Product name
Anti-SGCD
Provider product page
Atlas Antibodies - HPA026969
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAGNMEATCRTELRLESKDGEIKLDAAKIRLPRLP
HGSYTPTGTRQKVFEICVCANGRLFLSQAGAGSTC
QINT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -