Antibody data

Product number
H00006444-M01
Provider
Abnova Corporation
Product name
SGCD monoclonal antibody (M01), clone 3G10
Provider product page
Abnova Corporation - H00006444-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SGCD.
Antigen sequence
ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKL
LFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNV
RADPFK
Isotype
IgG
Antibody clone number
3G10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -